Special Offers

explore special ways to save on peptides

Sale

Save 17% on GLP-1

5 Vials of GLP-1 10mg

GLP-1 is a synthetic peptide designed for in vitro laboratory research. Structurally, it is an analog of glucagon-like peptide-1 (GLP-1) with specific modifications to enhance stability and receptor activity. These include:

  • Amino Acid Substitutions:

    • Position 8: Alanine (Ala) replaced by α-aminoisobutyric acid (Aib)

    • Position 34: Lysine (Lys) replaced by Arginine (Arg)

  • Acylation:

    • The ε-amino group of Lysine at position 26 is acylated with a spacer comprising two 8-amino-3,6-dioxaoctanoic acid (ADO) units, a glutamic acid residue, and a C18 fatty diacid chain.

Original price was: $1,235.00.Current price is: $1,035.00.

  • EUR: € 828.00

Sale

Save 20% on GLP-2

5 Vials of GLP-2 10mg

GLP-2 is a synthetic peptide designed specifically for laboratory research purposes. Structurally engineered to engage glucagon-like peptide-1 (GLP-1) and glucose-dependent insulinotropic polypeptide (GIP) receptors, GLP-2 facilitates studies exploring receptor interactions, signaling pathways, and metabolic processes in controlled experimental conditions.

Chemical Sequence:

HADGSFSDEMNTILDNLAARDFINWLIQTKITD

This product is intended strictly for in vitro laboratory research and is NOT approved for human or animal consumption. The purchaser must ensure compliance with all relevant laboratory protocols and regulatory guidelines.

Original price was: $1,485.00.Current price is: $1,185.00.

  • EUR: € 948.00

My cart
Your cart is empty.

Looks like you haven't made a choice yet.