GLP-2 – 5 Vials

GLP-2 is a synthetic peptide designed specifically for laboratory research purposes. Structurally engineered to engage glucagon-like peptide-1 (GLP-1) and glucose-dependent insulinotropic polypeptide (GIP) receptors, GLP-2 facilitates studies exploring receptor interactions, signaling pathways, and metabolic processes in controlled experimental conditions.

Chemical Sequence:
HADGSFSDEMNTILDNLAARDFINWLIQTKITD


This product is intended strictly for in-vitro laboratory research and is NOT approved for human or animal consumption. The purchaser must ensure compliance with all relevant laboratory protocols and regulatory guidelines.